Recombinant Human Hemoglobin subunit gamma-1 (HBG1), Unconjugated, E. coli

Catalog Number: BIM-RPC26070
Article Name: Recombinant Human Hemoglobin subunit gamma-1 (HBG1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26070
Supplier Catalog Number: RPC26070
Alternative Catalog Number: BIM-RPC26070-20UG,BIM-RPC26070-100UG,BIM-RPC26070-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Gamma-1-globin (Hb F Agamma, Hemoglobin gamma-1 chain, Hemoglobin gamma-A chain)
Recombinant Human Hemoglobin subunit gamma-1 (HBG1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HBG1. Target Synonyms: Gamma-1-globin (Hb F Agamma, Hemoglobin gamma-1 chain, Hemoglobin gamma-A chain). Accession Number: P69891. Expression Region: 2~147aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH
Target: HBG1