Recombinant Human Hemoglobin subunit gamma-1 (HBG1), Unconjugated, E. coli

Artikelnummer: BIM-RPC26070
Artikelname: Recombinant Human Hemoglobin subunit gamma-1 (HBG1), Unconjugated, E. coli
Artikelnummer: BIM-RPC26070
Hersteller Artikelnummer: RPC26070
Alternativnummer: BIM-RPC26070-20UG,BIM-RPC26070-100UG,BIM-RPC26070-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Gamma-1-globin (Hb F Agamma, Hemoglobin gamma-1 chain, Hemoglobin gamma-A chain)
Recombinant Human Hemoglobin subunit gamma-1 (HBG1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HBG1. Target Synonyms: Gamma-1-globin (Hb F Agamma, Hemoglobin gamma-1 chain, Hemoglobin gamma-A chain). Accession Number: P69891. Expression Region: 2~147aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 23.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH
Target-Kategorie: HBG1