Recombinant Human Ganglioside GM2 activator (GM2A), Unconjugated, E. coli

Catalog Number: BIM-RPC26025
Article Name: Recombinant Human Ganglioside GM2 activator (GM2A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26025
Supplier Catalog Number: RPC26025
Alternative Catalog Number: BIM-RPC26025-20UG,BIM-RPC26025-100UG,BIM-RPC26025-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cerebroside sulfate activator protein (GM2-AP, Sphingolipid activator protein 3)
Recombinant Human Ganglioside GM2 activator (GM2A) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GM2A. Target Synonyms: Cerebroside sulfate activator protein (GM2-AP, Sphingolipid activator protein 3). Accession Number: P17900. Expression Region: 32~193aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Target: GM2A