Recombinant Human Ganglioside GM2 activator (GM2A), Unconjugated, E. coli

Artikelnummer: BIM-RPC26025
Artikelname: Recombinant Human Ganglioside GM2 activator (GM2A), Unconjugated, E. coli
Artikelnummer: BIM-RPC26025
Hersteller Artikelnummer: RPC26025
Alternativnummer: BIM-RPC26025-20UG,BIM-RPC26025-100UG,BIM-RPC26025-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cerebroside sulfate activator protein (GM2-AP, Sphingolipid activator protein 3)
Recombinant Human Ganglioside GM2 activator (GM2A) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GM2A. Target Synonyms: Cerebroside sulfate activator protein (GM2-AP, Sphingolipid activator protein 3). Accession Number: P17900. Expression Region: 32~193aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Target-Kategorie: GM2A