Recombinant Mouse Serine protease HTRA1 (Htra1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25968
Article Name: Recombinant Mouse Serine protease HTRA1 (Htra1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25968
Supplier Catalog Number: RPC25968
Alternative Catalog Number: BIM-RPC25968-20UG,BIM-RPC25968-100UG,BIM-RPC25968-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: High-temperature requirement A serine peptidase 1 (Serine protease 11, Htra, Prss11)
Recombinant Mouse Serine protease HTRA1 (Htra1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Htra1. Target Synonyms: High-temperature requirement A serine peptidase 1 (Serine protease 11, Htra, Prss11). Accession Number: Q9R118. Expression Region: 141~480aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 39.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.0kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: KLRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAVTKKKYIGIRMMSLTSSKA
Target: Htra1