Recombinant Mouse Serine protease HTRA1 (Htra1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25968
Artikelname: Recombinant Mouse Serine protease HTRA1 (Htra1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25968
Hersteller Artikelnummer: RPC25968
Alternativnummer: BIM-RPC25968-20UG,BIM-RPC25968-100UG,BIM-RPC25968-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: High-temperature requirement A serine peptidase 1 (Serine protease 11, Htra, Prss11)
Recombinant Mouse Serine protease HTRA1 (Htra1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Htra1. Target Synonyms: High-temperature requirement A serine peptidase 1 (Serine protease 11, Htra, Prss11). Accession Number: Q9R118. Expression Region: 141~480aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 39.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 39.0kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: KLRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAVTKKKYIGIRMMSLTSSKA
Target-Kategorie: Htra1