Recombinant Neosartorya fumigata Vacuolar protease A (pep2), Unconjugated, E. coli

Catalog Number: BIM-RPC25823
Article Name: Recombinant Neosartorya fumigata Vacuolar protease A (pep2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25823
Supplier Catalog Number: RPC25823
Alternative Catalog Number: BIM-RPC25823-20UG,BIM-RPC25823-100UG,BIM-RPC25823-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Aspartic endopeptidase pep2 (Aspartic protease pep2)
Recombinant Neosartorya fumigata Vacuolar protease A (pep2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus). Target Name: pep2. Target Synonyms: Aspartic endopeptidase pep2 (Aspartic protease pep2). Accession Number: O42630. Expression Region: 71~398aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SRHDVLVDNFLNAQYFSEISLGTPPQKFKVVLDTGSSNLWVPGSDCSSIACFLHNKYDSSASSTYKANGTEFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEATNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYNMLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDKNHYTGELTKIPLRRKAYWEVDFDAIALGDNVAELENTGIILDTGTSLIALPSTLADLLNKEIGAKKGFTGQYSIECDKRD
Target: pep2