Recombinant Neosartorya fumigata Vacuolar protease A (pep2), Unconjugated, E. coli

Artikelnummer: BIM-RPC25823
Artikelname: Recombinant Neosartorya fumigata Vacuolar protease A (pep2), Unconjugated, E. coli
Artikelnummer: BIM-RPC25823
Hersteller Artikelnummer: RPC25823
Alternativnummer: BIM-RPC25823-20UG,BIM-RPC25823-100UG,BIM-RPC25823-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: Aspartic endopeptidase pep2 (Aspartic protease pep2)
Recombinant Neosartorya fumigata Vacuolar protease A (pep2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus). Target Name: pep2. Target Synonyms: Aspartic endopeptidase pep2 (Aspartic protease pep2). Accession Number: O42630. Expression Region: 71~398aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 39.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SRHDVLVDNFLNAQYFSEISLGTPPQKFKVVLDTGSSNLWVPGSDCSSIACFLHNKYDSSASSTYKANGTEFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEATNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYNMLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDKNHYTGELTKIPLRRKAYWEVDFDAIALGDNVAELENTGIILDTGTSLIALPSTLADLLNKEIGAKKGFTGQYSIECDKRD
Target-Kategorie: pep2