Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS), Unconjugated, E. coli

Catalog Number: BIM-RPC25810
Article Name: Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25810
Supplier Catalog Number: RPC25810
Alternative Catalog Number: BIM-RPC25810-20UG,BIM-RPC25810-100UG,BIM-RPC25810-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: 4-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)
Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes serotype M28 (strain MGAS6180). Target Name: acpS. Target Synonyms: 4-phosphopantetheinyl transferase AcpS (Holo-ACP synthase). Accession Number: Q48RM7. Expression Region: 1~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
Target: acpS