Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS), Unconjugated, E. coli

Artikelnummer: BIM-RPC25810
Artikelname: Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS), Unconjugated, E. coli
Artikelnummer: BIM-RPC25810
Hersteller Artikelnummer: RPC25810
Alternativnummer: BIM-RPC25810-20UG,BIM-RPC25810-100UG,BIM-RPC25810-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 4-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)
Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes serotype M28 (strain MGAS6180). Target Name: acpS. Target Synonyms: 4-phosphopantetheinyl transferase AcpS (Holo-ACP synthase). Accession Number: Q48RM7. Expression Region: 1~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
Target-Kategorie: acpS