Recombinant Human Proto-oncogene tyrosine-protein kinase Src (SRC), Unconjugated, E. coli

Catalog Number: BIM-RPC25809
Article Name: Recombinant Human Proto-oncogene tyrosine-protein kinase Src (SRC), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25809
Supplier Catalog Number: RPC25809
Alternative Catalog Number: BIM-RPC25809-20UG,BIM-RPC25809-100UG,BIM-RPC25809-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Proto-oncogene c-Src (pp60c-src, p60-Src, SRC1)
Recombinant Human Proto-oncogene tyrosine-protein kinase Src (SRC) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SRC. Target Synonyms: Proto-oncogene c-Src (pp60c-src, p60-Src, SRC1). Accession Number: P12931. Expression Region: 2~536aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 64.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 64.2kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQ
Target: SRC