Recombinant Human Proto-oncogene tyrosine-protein kinase Src (SRC), Unconjugated, E. coli

Artikelnummer: BIM-RPC25809
Artikelname: Recombinant Human Proto-oncogene tyrosine-protein kinase Src (SRC), Unconjugated, E. coli
Artikelnummer: BIM-RPC25809
Hersteller Artikelnummer: RPC25809
Alternativnummer: BIM-RPC25809-20UG,BIM-RPC25809-100UG,BIM-RPC25809-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Proto-oncogene c-Src (pp60c-src, p60-Src, SRC1)
Recombinant Human Proto-oncogene tyrosine-protein kinase Src (SRC) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SRC. Target Synonyms: Proto-oncogene c-Src (pp60c-src, p60-Src, SRC1). Accession Number: P12931. Expression Region: 2~536aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 64.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 64.2kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQ
Target-Kategorie: SRC