Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25802
Article Name: Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25802
Supplier Catalog Number: RPC25802
Alternative Catalog Number: BIM-RPC25802-20UG,BIM-RPC25802-100UG,BIM-RPC25802-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: BRG1-associated factor 47 (BAF47, Integrase interactor 1 protein, SNF5 homolog, hSNF5, BAF47, INI1, SNF5L1)
Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMARCB1. Target Synonyms: BRG1-associated factor 47 (BAF47, Integrase interactor 1 protein, SNF5 homolog, hSNF5, BAF47, INI1, SNF5L1). Accession Number: Q12824. Expression Region: 2~376aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 49.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILED
Target: SMARCB1