Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25802
Artikelname: Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25802
Hersteller Artikelnummer: RPC25802
Alternativnummer: BIM-RPC25802-20UG,BIM-RPC25802-100UG,BIM-RPC25802-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: BRG1-associated factor 47 (BAF47, Integrase interactor 1 protein, SNF5 homolog, hSNF5, BAF47, INI1, SNF5L1)
Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMARCB1. Target Synonyms: BRG1-associated factor 47 (BAF47, Integrase interactor 1 protein, SNF5 homolog, hSNF5, BAF47, INI1, SNF5L1). Accession Number: Q12824. Expression Region: 2~376aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 49.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.0kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILED
Target-Kategorie: SMARCB1