Recombinant Phytophthora cryptogea Beta-elicitin cryptogein, Unconjugated, E. coli

Catalog Number: BIM-RPC25793
Article Name: Recombinant Phytophthora cryptogea Beta-elicitin cryptogein, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25793
Supplier Catalog Number: RPC25793
Alternative Catalog Number: BIM-RPC25793-20UG,BIM-RPC25793-100UG,BIM-RPC25793-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: CRY
Recombinant Phytophthora cryptogea Beta-elicitin cryptogein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Phytophthora cryptogea. Target Name: Phytophthora cryptogea Beta-elicitin cryptogein. Target Synonyms: CRY. Accession Number: P15570. Expression Region: 21~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL
Target: Phytophthora cryptogea Beta-elicitin cryptogein