Recombinant Phytophthora cryptogea Beta-elicitin cryptogein, Unconjugated, E. coli

Artikelnummer: BIM-RPC25793
Artikelname: Recombinant Phytophthora cryptogea Beta-elicitin cryptogein, Unconjugated, E. coli
Artikelnummer: BIM-RPC25793
Hersteller Artikelnummer: RPC25793
Alternativnummer: BIM-RPC25793-20UG,BIM-RPC25793-100UG,BIM-RPC25793-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: CRY
Recombinant Phytophthora cryptogea Beta-elicitin cryptogein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Phytophthora cryptogea. Target Name: Phytophthora cryptogea Beta-elicitin cryptogein. Target Synonyms: CRY. Accession Number: P15570. Expression Region: 21~118aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL
Target-Kategorie: Phytophthora cryptogea Beta-elicitin cryptogein