Recombinant Shigella flexneri Glutaredoxin-4 (grxD), Unconjugated, E. coli

Catalog Number: BIM-RPC25773
Article Name: Recombinant Shigella flexneri Glutaredoxin-4 (grxD), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25773
Supplier Catalog Number: RPC25773
Alternative Catalog Number: BIM-RPC25773-20UG,BIM-RPC25773-100UG,BIM-RPC25773-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Monothiol glutaredoxin (ydhD, Grx4)
Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella flexneri. Target Name: grxD. Target Synonyms: Monothiol glutaredoxin (ydhD, Grx4). Accession Number: P0AC72. Expression Region: 1~115aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
Target: grxD