Recombinant Shigella flexneri Glutaredoxin-4 (grxD), Unconjugated, E. coli

Artikelnummer: BIM-RPC25773
Artikelname: Recombinant Shigella flexneri Glutaredoxin-4 (grxD), Unconjugated, E. coli
Artikelnummer: BIM-RPC25773
Hersteller Artikelnummer: RPC25773
Alternativnummer: BIM-RPC25773-20UG,BIM-RPC25773-100UG,BIM-RPC25773-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Monothiol glutaredoxin (ydhD, Grx4)
Recombinant Shigella flexneri Glutaredoxin-4 (grxD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella flexneri. Target Name: grxD. Target Synonyms: Monothiol glutaredoxin (ydhD, Grx4). Accession Number: P0AC72. Expression Region: 1~115aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
Target-Kategorie: grxD