Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin, Unconjugated, E. coli

Catalog Number: BIM-RPC25755
Article Name: Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25755
Supplier Catalog Number: RPC25755
Alternative Catalog Number: BIM-RPC25755-20UG,BIM-RPC25755-100UG,BIM-RPC25755-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Fibrinogen-clotting enzyme (Snake venom serine protease, SVSP, Venombin B)
Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Agkistrodon contortrix contortrix (Southern copperhead). Target Name: Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin. Target Synonyms: Fibrinogen-clotting enzyme (Snake venom serine protease, SVSP, Venombin B). Accession Number: P82981. Expression Region: 1~234aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP
Target: Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin