Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin, Unconjugated, E. coli

Artikelnummer: BIM-RPC25755
Artikelname: Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin, Unconjugated, E. coli
Artikelnummer: BIM-RPC25755
Hersteller Artikelnummer: RPC25755
Alternativnummer: BIM-RPC25755-20UG,BIM-RPC25755-100UG,BIM-RPC25755-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Fibrinogen-clotting enzyme (Snake venom serine protease, SVSP, Venombin B)
Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Agkistrodon contortrix contortrix (Southern copperhead). Target Name: Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin. Target Synonyms: Fibrinogen-clotting enzyme (Snake venom serine protease, SVSP, Venombin B). Accession Number: P82981. Expression Region: 1~234aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP
Target-Kategorie: Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin