Recombinant Mouse Prohibitin (Phb), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25743
Article Name: Recombinant Mouse Prohibitin (Phb), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25743
Supplier Catalog Number: RPC25743
Alternative Catalog Number: BIM-RPC25743-20UG,BIM-RPC25743-100UG,BIM-RPC25743-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: B-cell receptor-associated protein 32 (BAP 32)
Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Phb. Target Synonyms: B-cell receptor-associated protein 32 (BAP 32). Accession Number: P67778. Expression Region: 174~272aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.2kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Target: Phb