Recombinant Mouse Prohibitin (Phb), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25743
Artikelname: Recombinant Mouse Prohibitin (Phb), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25743
Hersteller Artikelnummer: RPC25743
Alternativnummer: BIM-RPC25743-20UG,BIM-RPC25743-100UG,BIM-RPC25743-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: B-cell receptor-associated protein 32 (BAP 32)
Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Phb. Target Synonyms: B-cell receptor-associated protein 32 (BAP 32). Accession Number: P67778. Expression Region: 174~272aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.2kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: TFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Target-Kategorie: Phb