Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C), Unconjugated, E. coli

Catalog Number: BIM-RPC25735
Article Name: Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25735
Supplier Catalog Number: RPC25735
Alternative Catalog Number: BIM-RPC25735-20UG,BIM-RPC25735-100UG,BIM-RPC25735-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: IMYPNO1 (PP2A subunit B isoform B55-gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A subunit B isoform gamma)
Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PPP2R2C. Target Synonyms: IMYPNO1 (PP2A subunit B isoform B55-gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A subunit B isoform gamma). Accession Number: Q9Y2T4. Expression Region: 1~447aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAA
Target: PPP2R2C