Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C), Unconjugated, E. coli

Artikelnummer: BIM-RPC25735
Artikelname: Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C), Unconjugated, E. coli
Artikelnummer: BIM-RPC25735
Hersteller Artikelnummer: RPC25735
Alternativnummer: BIM-RPC25735-20UG,BIM-RPC25735-100UG,BIM-RPC25735-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: IMYPNO1 (PP2A subunit B isoform B55-gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A subunit B isoform gamma)
Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PPP2R2C. Target Synonyms: IMYPNO1 (PP2A subunit B isoform B55-gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A subunit B isoform gamma). Accession Number: Q9Y2T4. Expression Region: 1~447aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAA
Target-Kategorie: PPP2R2C