Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25729
Article Name: Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25729
Supplier Catalog Number: RPC25729
Alternative Catalog Number: BIM-RPC25729-20UG,BIM-RPC25729-100UG,BIM-RPC25729-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G, hnRNP G, HNRPG, RBMXP1)
Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G, hnRNP G, HNRPG, RBMXP1). Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.4kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Target: RBMX