Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25729
Artikelname: Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25729
Hersteller Artikelnummer: RPC25729
Alternativnummer: BIM-RPC25729-20UG,BIM-RPC25729-100UG,BIM-RPC25729-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G, hnRNP G, HNRPG, RBMXP1)
Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G, hnRNP G, HNRPG, RBMXP1). Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.4kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Target-Kategorie: RBMX