Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1 (tbp1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25726
Article Name: Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1 (tbp1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25726
Supplier Catalog Number: RPC25726
Alternative Catalog Number: BIM-RPC25726-20UG,BIM-RPC25726-100UG,BIM-RPC25726-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: tbp1, NMB0461, Transferrin-binding protein 1
Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1 (tbp1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup B (strain MC58). Target Name: tbp1. Target Synonyms: tbp1, NMB0461, Transferrin-binding protein 1. Accession Number: Q9K0U9. Expression Region: 22~300aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 37.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGKLVKSSDTLSKEQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQSYTAQAALGGTRTAGSSGAINEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADDVIGEGRQWGIQSKTAYSGKNRGLTQSIALAGRIGGAEALLIHTGRRAGEIRAHEDAGRGVQSFNRLVPVEDSSNYAYFIVKEECKNGSYETCKANP
Target: tbp1