Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1 (tbp1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25726
Artikelname: Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1 (tbp1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25726
Hersteller Artikelnummer: RPC25726
Alternativnummer: BIM-RPC25726-20UG,BIM-RPC25726-100UG,BIM-RPC25726-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: tbp1, NMB0461, Transferrin-binding protein 1
Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1 (tbp1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup B (strain MC58). Target Name: tbp1. Target Synonyms: tbp1, NMB0461, Transferrin-binding protein 1. Accession Number: Q9K0U9. Expression Region: 22~300aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 37.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGKLVKSSDTLSKEQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQSYTAQAALGGTRTAGSSGAINEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADDVIGEGRQWGIQSKTAYSGKNRGLTQSIALAGRIGGAEALLIHTGRRAGEIRAHEDAGRGVQSFNRLVPVEDSSNYAYFIVKEECKNGSYETCKANP
Target-Kategorie: tbp1