Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5), Unconjugated, E. coli

Catalog Number: BIM-RPC25686
Article Name: Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25686
Supplier Catalog Number: RPC25686
Alternative Catalog Number: BIM-RPC25686-20UG,BIM-RPC25686-100UG,BIM-RPC25686-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DEAD box protein 5 (RNA helicase p68 G17P1, HELR, HLR1)
Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DDX5. Target Synonyms: DEAD box protein 5 (RNA helicase p68 G17P1, HELR, HLR1). Accession Number: P17844. Expression Region: 1~614aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 74.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 74.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLD
Target: DDX5