Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5), Unconjugated, E. coli

Artikelnummer: BIM-RPC25686
Artikelname: Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5), Unconjugated, E. coli
Artikelnummer: BIM-RPC25686
Hersteller Artikelnummer: RPC25686
Alternativnummer: BIM-RPC25686-20UG,BIM-RPC25686-100UG,BIM-RPC25686-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DEAD box protein 5 (RNA helicase p68 G17P1, HELR, HLR1)
Recombinant Human Probable ATP-dependent RNA helicase DDX5 (DDX5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DDX5. Target Synonyms: DEAD box protein 5 (RNA helicase p68 G17P1, HELR, HLR1). Accession Number: P17844. Expression Region: 1~614aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 74.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 74.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLD
Target-Kategorie: DDX5