Recombinant Human Prostaglandin E synthase 3 (PTGES3), Unconjugated, Yeast

Catalog Number: BIM-RPC25676
Article Name: Recombinant Human Prostaglandin E synthase 3 (PTGES3), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25676
Supplier Catalog Number: RPC25676
Alternative Catalog Number: BIM-RPC25676-20UG,BIM-RPC25676-100UG,BIM-RPC25676-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cytosolic prostaglandin E2 synthase (cPGES, Hsp90 co-chaperone, Progesterone receptor complex p23, Telomerase-binding protein p23)
Recombinant Human Prostaglandin E synthase 3 (PTGES3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTGES3. Target Synonyms: Cytosolic prostaglandin E2 synthase (cPGES, Hsp90 co-chaperone, Progesterone receptor complex p23, Telomerase-binding protein p23). Accession Number: Q15185. Expression Region: 1~160aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.2kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Target: PTGES3