Recombinant Human Prostaglandin E synthase 3 (PTGES3), Unconjugated, Yeast

Artikelnummer: BIM-RPC25676
Artikelname: Recombinant Human Prostaglandin E synthase 3 (PTGES3), Unconjugated, Yeast
Artikelnummer: BIM-RPC25676
Hersteller Artikelnummer: RPC25676
Alternativnummer: BIM-RPC25676-20UG,BIM-RPC25676-100UG,BIM-RPC25676-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cytosolic prostaglandin E2 synthase (cPGES, Hsp90 co-chaperone, Progesterone receptor complex p23, Telomerase-binding protein p23)
Recombinant Human Prostaglandin E synthase 3 (PTGES3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTGES3. Target Synonyms: Cytosolic prostaglandin E2 synthase (cPGES, Hsp90 co-chaperone, Progesterone receptor complex p23, Telomerase-binding protein p23). Accession Number: Q15185. Expression Region: 1~160aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.2kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Target-Kategorie: PTGES3