Recombinant Human Ficolin-3 (FCN3), Unconjugated, E. coli

Catalog Number: BIM-RPC25666
Article Name: Recombinant Human Ficolin-3 (FCN3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25666
Supplier Catalog Number: RPC25666
Alternative Catalog Number: BIM-RPC25666-20UG,BIM-RPC25666-100UG,BIM-RPC25666-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Collagen/fibrinogen domain-containing lectin 3 p35Collagen/fibrinogen domain-containing protein 3Hakata antigenFCNH, HAKA1
Recombinant Human Ficolin-3 (FCN3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FCN3. Target Synonyms: Collagen/fibrinogen domain-containing lectin 3 p35Collagen/fibrinogen domain-containing protein 3Hakata antigenFCNH, HAKA1. Accession Number: O75636. Expression Region: 24~299aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 34.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.8kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYG
Target: FCN3