Recombinant Human Ficolin-3 (FCN3), Unconjugated, E. coli

Artikelnummer: BIM-RPC25666
Artikelname: Recombinant Human Ficolin-3 (FCN3), Unconjugated, E. coli
Artikelnummer: BIM-RPC25666
Hersteller Artikelnummer: RPC25666
Alternativnummer: BIM-RPC25666-20UG,BIM-RPC25666-100UG,BIM-RPC25666-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Collagen/fibrinogen domain-containing lectin 3 p35Collagen/fibrinogen domain-containing protein 3Hakata antigenFCNH, HAKA1
Recombinant Human Ficolin-3 (FCN3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FCN3. Target Synonyms: Collagen/fibrinogen domain-containing lectin 3 p35Collagen/fibrinogen domain-containing protein 3Hakata antigenFCNH, HAKA1. Accession Number: O75636. Expression Region: 24~299aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 34.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 34.8kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYG
Target-Kategorie: FCN3