Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2), Unconjugated, E. coli

Catalog Number: BIM-RPC25621
Article Name: Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25621
Supplier Catalog Number: RPC25621
Alternative Catalog Number: BIM-RPC25621-20UG,BIM-RPC25621-100UG,BIM-RPC25621-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Spink2, Serine protease inhibitor Kazal-type 2
Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Spink2. Target Synonyms: Spink2, Serine protease inhibitor Kazal-type 2. Accession Number: Q8BMY7. Expression Region: 17~86aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 15.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
Target: Spink2