Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2), Unconjugated, E. coli

Artikelnummer: BIM-RPC25621
Artikelname: Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2), Unconjugated, E. coli
Artikelnummer: BIM-RPC25621
Hersteller Artikelnummer: RPC25621
Alternativnummer: BIM-RPC25621-20UG,BIM-RPC25621-100UG,BIM-RPC25621-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Spink2, Serine protease inhibitor Kazal-type 2
Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Spink2. Target Synonyms: Spink2, Serine protease inhibitor Kazal-type 2. Accession Number: Q8BMY7. Expression Region: 17~86aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
Target-Kategorie: Spink2