Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1), Unconjugated, Yeast

Catalog Number: BIM-RPC25610
Article Name: Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25610
Supplier Catalog Number: RPC25610
Alternative Catalog Number: BIM-RPC25610-20UG,BIM-RPC25610-100UG,BIM-RPC25610-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: 58 kDa fibrinogen-binding mannoproteinFBP1
Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). Target Name: PRA1. Target Synonyms: 58 kDa fibrinogen-binding mannoproteinFBP1. Accession Number: P87020. Expression Region: 16~299aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASS
Target: PRA1