Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25610
Artikelname: Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25610
Hersteller Artikelnummer: RPC25610
Alternativnummer: BIM-RPC25610-20UG,BIM-RPC25610-100UG,BIM-RPC25610-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: 58 kDa fibrinogen-binding mannoproteinFBP1
Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). Target Name: PRA1. Target Synonyms: 58 kDa fibrinogen-binding mannoproteinFBP1. Accession Number: P87020. Expression Region: 16~299aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASS
Target-Kategorie: PRA1