Recombinant Human Orexin receptor type 1 (HCRTR1), Unconjugated, Yeast

Catalog Number: BIM-RPC25604
Article Name: Recombinant Human Orexin receptor type 1 (HCRTR1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25604
Supplier Catalog Number: RPC25604
Alternative Catalog Number: BIM-RPC25604-20UG,BIM-RPC25604-100UG,BIM-RPC25604-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Hypocretin receptor type 1
Recombinant Human Orexin receptor type 1 (HCRTR1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HCRTR1. Target Synonyms: Hypocretin receptor type 1. Accession Number: O43613. Expression Region: 1~46aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 21.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.4kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Target: HCRTR1