Recombinant Human Orexin receptor type 1 (HCRTR1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25604
Artikelname: Recombinant Human Orexin receptor type 1 (HCRTR1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25604
Hersteller Artikelnummer: RPC25604
Alternativnummer: BIM-RPC25604-20UG,BIM-RPC25604-100UG,BIM-RPC25604-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Hypocretin receptor type 1
Recombinant Human Orexin receptor type 1 (HCRTR1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HCRTR1. Target Synonyms: Hypocretin receptor type 1. Accession Number: O43613. Expression Region: 1~46aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 21.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.4kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Target-Kategorie: HCRTR1