Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25600
Article Name: Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25600
Supplier Catalog Number: RPC25600
Alternative Catalog Number: BIM-RPC25600-20UG,BIM-RPC25600-100UG,BIM-RPC25600-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Adenocarcinoma-associated antigenCell surface glycoprotein Trop-1Epithelial cell surface antigenEpithelial glycoproteinEGPEpithelial glycoprotein 314EGP314hEGP314KS 1/4 antigenKSAMajor gastrointestinal tumor-associated protein GA733-2Tumor-associated calcium signal transducer 1CD_antigen: CD326
Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: EPCAM. Target Synonyms: Adenocarcinoma-associated antigenCell surface glycoprotein Trop-1Epithelial cell surface antigenEpithelial glycoproteinEGPEpithelial glycoprotein 314EGP314hEGP314KS 1/4 antigenKSAMajor gastrointestinal tumor-associated protein GA733-2. Accession Number: P16422. Expression Region: 24~265aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 40.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 40.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Target: EPCAM