Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25600
Artikelname: Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25600
Hersteller Artikelnummer: RPC25600
Alternativnummer: BIM-RPC25600-20UG,BIM-RPC25600-100UG,BIM-RPC25600-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Adenocarcinoma-associated antigenCell surface glycoprotein Trop-1Epithelial cell surface antigenEpithelial glycoproteinEGPEpithelial glycoprotein 314EGP314hEGP314KS 1/4 antigenKSAMajor gastrointestinal tumor-associated protein GA733-2Tumor-associated calcium signal transducer 1CD_antigen: CD326
Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: EPCAM. Target Synonyms: Adenocarcinoma-associated antigenCell surface glycoprotein Trop-1Epithelial cell surface antigenEpithelial glycoproteinEGPEpithelial glycoprotein 314EGP314hEGP314KS 1/4 antigenKSAMajor gastrointestinal tumor-associated protein GA733-2. Accession Number: P16422. Expression Region: 24~265aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 40.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 40.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Target-Kategorie: EPCAM