Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2), Unconjugated, E. coli

Catalog Number: BIM-RPC25583
Article Name: Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25583
Supplier Catalog Number: RPC25583
Alternative Catalog Number: BIM-RPC25583-20UG,BIM-RPC25583-100UG,BIM-RPC25583-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ATP-dependent RNA helicase eIF4A-2
Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: EIF4A2. Target Synonyms: ATP-dependent RNA helicase eIF4A-2. Accession Number: Q14240. Expression Region: 1~407aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 73.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 73.4kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVE
Target: EIF4A2