Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2), Unconjugated, E. coli

Artikelnummer: BIM-RPC25583
Artikelname: Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2), Unconjugated, E. coli
Artikelnummer: BIM-RPC25583
Hersteller Artikelnummer: RPC25583
Alternativnummer: BIM-RPC25583-20UG,BIM-RPC25583-100UG,BIM-RPC25583-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: ATP-dependent RNA helicase eIF4A-2
Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: EIF4A2. Target Synonyms: ATP-dependent RNA helicase eIF4A-2. Accession Number: Q14240. Expression Region: 1~407aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 73.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 73.4kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVE
Target-Kategorie: EIF4A2