Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab), Unconjugated, Yeast

Catalog Number: BIM-RPC25537
Article Name: Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25537
Supplier Catalog Number: RPC25537
Alternative Catalog Number: BIM-RPC25537-20UG,BIM-RPC25537-100UG,BIM-RPC25537-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Protein kinase C inhibitor protein 1
Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ywhab. Target Synonyms: Protein kinase C inhibitor protein 1. Accession Number: Q9CQV8. Expression Region: 1~246aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 30.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.6kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Target: Ywhab