Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab), Unconjugated, Yeast

Artikelnummer: BIM-RPC25537
Artikelname: Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab), Unconjugated, Yeast
Artikelnummer: BIM-RPC25537
Hersteller Artikelnummer: RPC25537
Alternativnummer: BIM-RPC25537-20UG,BIM-RPC25537-100UG,BIM-RPC25537-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Protein kinase C inhibitor protein 1
Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ywhab. Target Synonyms: Protein kinase C inhibitor protein 1. Accession Number: Q9CQV8. Expression Region: 1~246aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 30.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.6kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Target-Kategorie: Ywhab