Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta, Unconjugated, Yeast

Catalog Number: BIM-RPC25530
Article Name: Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25530
Supplier Catalog Number: RPC25530
Alternative Catalog Number: BIM-RPC25530-20UG,BIM-RPC25530-100UG,BIM-RPC25530-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Reptile
Conjugation: Unconjugated
Alternative Names: Aggretin beta chainRhodoaggretin subunit beta
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma). Target Name: Calloselasma rhodostoma Snaclec rhodocytin subunit beta. Target Synonyms: Aggretin beta chainRhodoaggretin subunit beta. Accession Number: Q9I840. Expression Region: 24~146aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Target: Calloselasma rhodostoma Snaclec rhodocytin subunit beta