Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta, Unconjugated, Yeast

Artikelnummer: BIM-RPC25530
Artikelname: Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta, Unconjugated, Yeast
Artikelnummer: BIM-RPC25530
Hersteller Artikelnummer: RPC25530
Alternativnummer: BIM-RPC25530-20UG,BIM-RPC25530-100UG,BIM-RPC25530-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Reptile
Konjugation: Unconjugated
Alternative Synonym: Aggretin beta chainRhodoaggretin subunit beta
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma). Target Name: Calloselasma rhodostoma Snaclec rhodocytin subunit beta. Target Synonyms: Aggretin beta chainRhodoaggretin subunit beta. Accession Number: Q9I840. Expression Region: 24~146aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Target-Kategorie: Calloselasma rhodostoma Snaclec rhodocytin subunit beta