Recombinant Bovine Adiponectin (ADIPOQ), Unconjugated, Yeast

Catalog Number: BIM-RPC25391
Article Name: Recombinant Bovine Adiponectin (ADIPOQ), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25391
Supplier Catalog Number: RPC25391
Alternative Catalog Number: BIM-RPC25391-20UG,BIM-RPC25391-100UG,BIM-RPC25391-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipose most abundant gene transcript 1 protein, apM-1
Recombinant Bovine Adiponectin (ADIPOQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: ADIPOQ. Target Synonyms: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipose most abundant gene transcript 1 protein, apM-1. Accession Number: Q3Y5Z3. Expression Region: 18~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Target: ADIPOQ