Recombinant Bovine Adiponectin (ADIPOQ), Unconjugated, Yeast

Artikelnummer: BIM-RPC25391
Artikelname: Recombinant Bovine Adiponectin (ADIPOQ), Unconjugated, Yeast
Artikelnummer: BIM-RPC25391
Hersteller Artikelnummer: RPC25391
Alternativnummer: BIM-RPC25391-20UG,BIM-RPC25391-100UG,BIM-RPC25391-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipose most abundant gene transcript 1 protein, apM-1
Recombinant Bovine Adiponectin (ADIPOQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: ADIPOQ. Target Synonyms: 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipose most abundant gene transcript 1 protein, apM-1. Accession Number: Q3Y5Z3. Expression Region: 18~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 26.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Target-Kategorie: ADIPOQ